PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G11530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 304aa    MW: 34734.6 Da    PI: 11.9123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G11530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.4e-154388348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd  l ++  + G+++W+++a+ m+ +R++ qc++rw+++l
  OMERI06G11530.1 43 AWTPEEDAALERLAMENGSRHWRRVAAQMPRKRSPVQCRDRWRDHL 88
                     7*****************************99***********986 PP

2Myb_DNA-binding46.96.2e-15194241348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48 
                      +WT+eEd  l ++ ++ G+++W+++a+ m+   +R++ qc++rw+++l
  OMERI06G11530.1 194 AWTPEEDAVLERLATENGSRHWRRVAAQMPrrRRRSPAQCRDRWRDHL 241
                      7********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0693692IPR017930Myb domain
SMARTSM007171.1E-114090IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-1942138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-1643100IPR009057Homeodomain-like
PfamPF002491.3E-144388IPR001005SANT/Myb domain
CDDcd001671.24E-104388No hitNo description
SMARTSM007170.01793144IPR001005SANT/Myb domain
CDDcd001670.0010996141No hitNo description
PROSITE profilePS500907.14396142IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.0E-7101140IPR009057Homeodomain-like
PROSITE profilePS5129417.39181245IPR017930Myb domain
SMARTSM007171.5E-10191243IPR001005SANT/Myb domain
SuperFamilySSF466892.11E-15194277IPR009057Homeodomain-like
CDDcd001673.62E-9194241No hitNo description
Gene3DG3DSA:1.10.10.603.2E-13194241IPR009057Homeodomain-like
PfamPF002492.6E-13194241IPR001005SANT/Myb domain
PROSITE profilePS500905.784250277IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.600.001250278IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAMMEPSSSS SNAVADDQCA SAVTQPSAPP SGRCILRIRL PPAWTPEEDA ALERLAMENG  60
SRHWRRVAAQ MPRKRSPVQC RDRWRDHLAL DVFHRPYTAA DDDELTRLVL RPGGGGDRWK  120
DISRAVHGRS SRSVKRRWME IGTSDELLRK LWHPRSSMLS PATVVDAVLS SSSSAASVFA  180
RRRRRSGGAS LPPAWTPEED AVLERLATEN GSRHWRRVAA QMPRRRRRSP AQCRDRWRDH  240
LGRLCLRLDG GERWKDISRA VYGRSSRAVK RRWRELRKSD AFLGKLWCRP LSPIANPAMF  300
RKTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osg_D7e-144414314108MYB21
3osg_A7e-144414314108MYB21
3osf_D7e-144414314108MYB21
3osf_A7e-144414314108MYB21
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266271RAVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0055270.0AP005527.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0603C10.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642266.11e-82PREDICTED: transcription factor MYB44-like
TrEMBLA0A0E0E0450.0A0A0E0E045_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g14700.14e-82(Oryza sativa Japonica Group)
STRINGORGLA06G0093600.14e-82(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-15myb domain protein 73